(data stored in ACNUC7421 zone)

EMBL: AM286690.MRCB

AM286690.MRCB        Location/Qualifiers
FT   CDS             386950..389340
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ABO_0351"
FT                   /product="penicillin-binding protein"
FT                   /note="unknown EC_number 2.4.2.129"
FT                   /note="(penicillin-binding protein 1B (PBP-1b) (PBP1b)
FT                   (Murein polymerase)[Includes: Penicillin-insensitive
FT                   transglycosylase (EC 2.4.1.129)(Peptidoglycan
FT                   glycosyltransferase) (Peptidoglycan TGase);
FT                   Penicillin-sensitive transpeptidase (EC 3.4.-.-)
FT                   (DD-transpeptidase)]) identified by sequencesimilarity;
FT                   putative InterPro: Penicillin binding protein
FT                   transpeptidase domain"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15799"
FT                   /db_xref="GOA:Q0VSP9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSP9"
FT                   /protein_id="CAL15799.1"
FT                   /translation="MFLHTHKVPTIFSILRPMAKKTKKSPAKSRRQPSRKKKPSSSRRR
FT                   WFSWPFIAKVSLVCLVLGAAGLAYLDALVRERFDSHAWQLPARVYARPVELYEGRVLSK
FT                   DDMLKLLDLMRYRRDARASTPGSFTVQGHSLLIHTRGFNDSDGGEQPERIRLSLSGGQI
FT                   RSLEAGGDRLARLEPLQIGSIHPQHAEDRVLVPLDKAPPLLVDMLIATEDRSFYDHHGI
FT                   SLRGLSRAMLANIKAGSLVQGGSTLTQQLVKNFWLSSDRTLSRKLMEMPMALLLELHYS
FT                   KEQILEAYLNEVYLGQDGARAIHGMGLGSQFLFGRPLTELEPHQLATLVALLKGPSWYD
FT                   PRRRPERAMERRNTVLKVARDEGALSNANYEKFSARPLEVVPRGASALYAFPAFIDLVR
FT                   RQLARDYPPEVLSDEGLHIHSTLDVLAQLAAEGSLKDHLDHRDPKQAKKLNGAVVVVAP
FT                   AQGDVLALVSNRDSRQAGFNRALDAQRPMGSLAKPAVVLSAVEQPKTYSLATLVEDGPI
FT                   QVKLPNGSVWSPQNFDKKAKGAMPMVDVLALSRNQATARLGLDVGLDKVADTMKTLGVT
FT                   RNIPLYPSILLGSLELTPFEVAMMYQPLATGGFSTRLRSITDVLDKDGRPLARYPVSTD
FT                   EVVDAGPAFLTQWAMQQVVEQGTARAARASLPADLRVAGKTGTSDDFRDAWFAGFSANH
FT                   LAVVWVGRDDNKNAGITGSSGALPVWAKLMGKLPQRSLSQTPPASVKWVWMNKDGRRVS
FT                   AEGCGNARRYPMLVASIPEDSDGCGTVKQTGKGIKGWFKGLFD"
     MFLHTHKVPT IFSILRPMAK KTKKSPAKSR RQPSRKKKPS SSRRRWFSWP FIAKVSLVCL        60
     VLGAAGLAYL DALVRERFDS HAWQLPARVY ARPVELYEGR VLSKDDMLKL LDLMRYRRDA       120
     RASTPGSFTV QGHSLLIHTR GFNDSDGGEQ PERIRLSLSG GQIRSLEAGG DRLARLEPLQ       180
     IGSIHPQHAE DRVLVPLDKA PPLLVDMLIA TEDRSFYDHH GISLRGLSRA MLANIKAGSL       240
     VQGGSTLTQQ LVKNFWLSSD RTLSRKLMEM PMALLLELHY SKEQILEAYL NEVYLGQDGA       300
     RAIHGMGLGS QFLFGRPLTE LEPHQLATLV ALLKGPSWYD PRRRPERAME RRNTVLKVAR       360
     DEGALSNANY EKFSARPLEV VPRGASALYA FPAFIDLVRR QLARDYPPEV LSDEGLHIHS       420
     TLDVLAQLAA EGSLKDHLDH RDPKQAKKLN GAVVVVAPAQ GDVLALVSNR DSRQAGFNRA       480
     LDAQRPMGSL AKPAVVLSAV EQPKTYSLAT LVEDGPIQVK LPNGSVWSPQ NFDKKAKGAM       540
     PMVDVLALSR NQATARLGLD VGLDKVADTM KTLGVTRNIP LYPSILLGSL ELTPFEVAMM       600
     YQPLATGGFS TRLRSITDVL DKDGRPLARY PVSTDEVVDA GPAFLTQWAM QQVVEQGTAR       660
     AARASLPADL RVAGKTGTSD DFRDAWFAGF SANHLAVVWV GRDDNKNAGI TGSSGALPVW       720
     AKLMGKLPQR SLSQTPPASV KWVWMNKDGR RVSAEGCGNA RRYPMLVASI PEDSDGCGTV       780
     KQTGKGIKGW FKGLFD                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page