(data stored in ACNUC7421 zone)

EMBL: AM286690.MREB

AM286690.MREB        Location/Qualifiers
FT   CDS             583140..584177
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="ABO_0530"
FT                   /product="rod shape-determining protein MreB"
FT                   /function="involved in formation of the rod shape of the
FT                   cell. may act as a negative regulator of ftsi"
FT                   /note="identified by sequence similarity; putative
FT                   InterPro: Cell shape determining protein MreB/Mrl"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15978"
FT                   /db_xref="GOA:Q0VS70"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS70"
FT                   /protein_id="CAL15978.1"
FT                   /translation="MIKRIRGMFSTDLSIDLGTANTLIYVRGRGIVLDEPSVVAIRHHG
FT                   AQKSVAAVGADAKRMLGRTPGNITAIRPMKDGVIADFDVTEKMLQYFIKKVHDTGFFPP
FT                   APRVLVCVPCKSTQVERRAIQDSAYGAGARDVYLIEEPMAAAIGAGLPVEEARGSMVVD
FT                   IGGGTTEIALISLNGVVYSESVRIGGDRFDEAIVAFVRKEYGSLIGESTAERIKHEIGT
FT                   AYPGAEIREIDVRGRNLAEGVPRSFTLNSEEILEALKEPLASIVNAVKNALEASPPELA
FT                   SDIAERGLVITGGGALLRDIDRLLSEETGLPVIVADDPLTCVARGGGKALELMDSQGFD
FT                   MLAMG"
     MIKRIRGMFS TDLSIDLGTA NTLIYVRGRG IVLDEPSVVA IRHHGAQKSV AAVGADAKRM        60
     LGRTPGNITA IRPMKDGVIA DFDVTEKMLQ YFIKKVHDTG FFPPAPRVLV CVPCKSTQVE       120
     RRAIQDSAYG AGARDVYLIE EPMAAAIGAG LPVEEARGSM VVDIGGGTTE IALISLNGVV       180
     YSESVRIGGD RFDEAIVAFV RKEYGSLIGE STAERIKHEI GTAYPGAEIR EIDVRGRNLA       240
     EGVPRSFTLN SEEILEALKE PLASIVNAVK NALEASPPEL ASDIAERGLV ITGGGALLRD       300
     IDRLLSEETG LPVIVADDPL TCVARGGGKA LELMDSQGFD MLAMG                       345
//

If you have problems or comments...

PBIL Back to PBIL home page