(data stored in ACNUC7421 zone)

EMBL: AM286690.MREC

AM286690.MREC        Location/Qualifiers
FT   CDS             584183..585037
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="ABO_0531"
FT                   /product="rod shape determining protein MreC"
FT                   /function="involved in formation of the rod shape of the
FT                   cell. may also contribute to regulation of formation of
FT                   penicillin-binding proteins"
FT                   /note="identified by sequencesimilarity; putative"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15979"
FT                   /db_xref="GOA:Q0VS69"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS69"
FT                   /protein_id="CAL15979.1"
FT                   /translation="MVAPAKSSYRVIIALVLAVVMMVLDQRTPWAAPVRHVLGYLTAPI
FT                   HYLAHLPVDSGEWLSEQTQSRGTLLDENRRLQRQALILEQKVQRLAVLEAENVRLRELL
FT                   NSSADLDANVLVAEIIGVDPDPNRQEIVINKGTGDNVFRGQAVLDSQGLIGQVVDAGPL
FT                   SSRVLLITDASHAMSVQVNRNGVRAVLAGVGQSSGLKLLYVPDTAGIQQGDLLVSTGLG
FT                   QLYPRGYPVASVTSVNHQAGTPFAHITARPTAQLDRASHVLLVQPTQAPQARPTPAEAD
FT                   NGQ"
     MVAPAKSSYR VIIALVLAVV MMVLDQRTPW AAPVRHVLGY LTAPIHYLAH LPVDSGEWLS        60
     EQTQSRGTLL DENRRLQRQA LILEQKVQRL AVLEAENVRL RELLNSSADL DANVLVAEII       120
     GVDPDPNRQE IVINKGTGDN VFRGQAVLDS QGLIGQVVDA GPLSSRVLLI TDASHAMSVQ       180
     VNRNGVRAVL AGVGQSSGLK LLYVPDTAGI QQGDLLVSTG LGQLYPRGYP VASVTSVNHQ       240
     AGTPFAHITA RPTAQLDRAS HVLLVQPTQA PQARPTPAEA DNGQ                        284
//

If you have problems or comments...

PBIL Back to PBIL home page