(data stored in ACNUC7421 zone)

EMBL: AM286690.MURG

AM286690.MURG        Location/Qualifiers
FT   CDS             655984..657057
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ABO_0598"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentap
FT                   eptide)pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /function="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="(UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapep
FT                   tide) pyrophosphoryl-undecaprenolN-acetylglucosamine
FT                   transferase) identified by match to PFAM protein family
FT                   HMMPF04101 InterPro: Glycosyltransferase family 28"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAL16046"
FT                   /db_xref="GOA:Q0VS02"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VS02"
FT                   /inference="protein motif:HMMPFAM:HMMPF04101"
FT                   /protein_id="CAL16046.1"
FT                   /translation="MSGTVLIMAGGTGGHVFPALAVADQLRTRGFDILWLGAENGMEGN
FT                   LVRQYGYEIAELSVSRLRGGGIKRKLTAPFNLLRAVLQARQLIRARQPVLAVGFGGFAS
FT                   GPGGLAARLCKVPVVVHEQNAVPGLTNRLLSRLSTVTLEGFQGAFGHPQACWVGNPVRP
FT                   QITALEEPARRYAQHQGGLRVLVLGGSQGALVLNQDLPELLLAVLGRDIQVRHQCGAGR
FT                   TAEAAPIYQALGLQAQVSEFIDDMAEAYGWADLVICRAGALTVAEVAAAGVAALFVPLP
FT                   SAVDDHQTLNARWLSERGAALLLPQRDLGAVSLAGTLKPVAERGLLAQIAERAREQAMA
FT                   DSAERAATLCEEVANGR"
     MSGTVLIMAG GTGGHVFPAL AVADQLRTRG FDILWLGAEN GMEGNLVRQY GYEIAELSVS        60
     RLRGGGIKRK LTAPFNLLRA VLQARQLIRA RQPVLAVGFG GFASGPGGLA ARLCKVPVVV       120
     HEQNAVPGLT NRLLSRLSTV TLEGFQGAFG HPQACWVGNP VRPQITALEE PARRYAQHQG       180
     GLRVLVLGGS QGALVLNQDL PELLLAVLGR DIQVRHQCGA GRTAEAAPIY QALGLQAQVS       240
     EFIDDMAEAY GWADLVICRA GALTVAEVAA AGVAALFVPL PSAVDDHQTL NARWLSERGA       300
     ALLLPQRDLG AVSLAGTLKP VAERGLLAQI AERAREQAMA DSAERAATLC EEVANGR          357
//

If you have problems or comments...

PBIL Back to PBIL home page