(data stored in ACNUC7421 zone)

EMBL: AM286690.NARH

AM286690.NARH        Location/Qualifiers
FT   CDS             complement(600590..602143)
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="ABO_0545"
FT                   /product="Respiratory nitrate reductase 1 beta chain"
FT                   /function="this is a second nitrate reductase enzyme which
FT                   can substitute for the nra enzyme and allows e.coli to use
FT                   nitrate as an electron acceptor during anaerobic growth.
FT                   the beta chain is an electron transfer unit containing four
FT                   cysteine clusters involved in the formation of iron-sulfur
FT                   centres. electrons are transferred from the gamma chain to
FT                   the molybdenum cofactor of the alpha subunit. nitrite +
FT                   acceptor = nitrate + reduced acceptor."
FT                   /EC_number="1.7.99.4"
FT                   /note="narH. Respiratory nitrate reductase 1 beta chain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15993"
FT                   /db_xref="GOA:Q0VS55"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VS55"
FT                   /protein_id="CAL15993.1"
FT                   /translation="MKIRSQVGMVLNLDKCIGCHTCSVTCKNVWTSREGVEYAWFNNVE
FT                   TKPGIGYPKEWENQKKWNGGWMRRLGDGKIEPRIGGKWRVLANLFANPDLPEIDDYYEP
FT                   FDFDYQHLHTAKAGKHQPVARPRSLITGKRIKKIEWGPNWEEILGTEFAKRRKDINFEQ
FT                   VQADIYGQFENTFMMYLPRLCEHCLNPTCVASCPSGAIYKREEDGIVLIDQDKCRGWRM
FT                   CVSGCPYKKIYYNWKSGKSEKCIFCYPRIEAGEPTVCSETCVGRIRYLGILLYDADRIS
FT                   EVASTADERDLYHRQRDIFLDPNNPEVIAQAQRDGISDNVIAAAQASPVYKLAMDWGLA
FT                   LPLHPEYRTLPMVWYVPPLSPIQSAAQAGKIEYDGVLPRIESLRIPVRYLANMLTAGEE
FT                   QPVVLALKRLMAMRVYMRDKHVEGHINKEVVDAVGLSEQQVEEMYRYLAIANYEDRFVI
FT                   PSSHREQAREAFPERGGCGFSFGDGCHSGQSKSNLFGARPQTRTLVSPQTYDPQESPHE
FT                   "
     MKIRSQVGMV LNLDKCIGCH TCSVTCKNVW TSREGVEYAW FNNVETKPGI GYPKEWENQK        60
     KWNGGWMRRL GDGKIEPRIG GKWRVLANLF ANPDLPEIDD YYEPFDFDYQ HLHTAKAGKH       120
     QPVARPRSLI TGKRIKKIEW GPNWEEILGT EFAKRRKDIN FEQVQADIYG QFENTFMMYL       180
     PRLCEHCLNP TCVASCPSGA IYKREEDGIV LIDQDKCRGW RMCVSGCPYK KIYYNWKSGK       240
     SEKCIFCYPR IEAGEPTVCS ETCVGRIRYL GILLYDADRI SEVASTADER DLYHRQRDIF       300
     LDPNNPEVIA QAQRDGISDN VIAAAQASPV YKLAMDWGLA LPLHPEYRTL PMVWYVPPLS       360
     PIQSAAQAGK IEYDGVLPRI ESLRIPVRYL ANMLTAGEEQ PVVLALKRLM AMRVYMRDKH       420
     VEGHINKEVV DAVGLSEQQV EEMYRYLAIA NYEDRFVIPS SHREQAREAF PERGGCGFSF       480
     GDGCHSGQSK SNLFGARPQT RTLVSPQTYD PQESPHE                                517
//

If you have problems or comments...

PBIL Back to PBIL home page