(data stored in ACNUC7421 zone)

EMBL: AM286690.NUSA

AM286690.NUSA        Location/Qualifiers
FT   CDS             358688..360265
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="ABO_0328"
FT                   /product="transcription elongation factor"
FT                   /function="participates in both the termination and
FT                   antitermination of transcription. interacts with rna
FT                   polymerase and binds rna (by similarity)."
FT                   /note="identified by sequence similarity. InterPro: S1 RNA
FT                   binding domain"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15776"
FT                   /db_xref="GOA:Q0VSS2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSS2"
FT                   /protein_id="CAL15776.1"
FT                   /translation="MLGCSPASIEYALKNFSLCKGLAMNKEILLVAETVSNEKGVSRDV
FT                   IFEAIELALAAATKKRFKQEDVEIRVDIDRESGNARSFRVWHVVPDEELFEFGKQLTLD
FT                   EAHEQDTSLQIGDIWEEEVESEAFGRIAAQTAKQVIVQKVREAERRQIVEEYRDRIGDL
FT                   VSGTVKKASRDSIVLDLGGNAEALITREHMIPREAVRQNDRVRAYLLGVNEENRGPQLF
FT                   ASRACPDMLVELFKIEVPEIGEELIEIKGAARDPGSRAKIAVKTNDQRIDPVGACVGMR
FT                   GARVQAVSNELAGERIDIVLWDDNPAQLVINAMQPAEVASIVMDEESHSMDIAVEDESA
FT                   LAQAIGRSGQNIRLASELTGWELNVMTIDDAESKQEQEAEQALQTFINELEVDEDVAGV
FT                   LVDEGFSTLEEVAYVPEEEMLAIDGFDEEIVELLRQRAKDALLTKALVSEEKFDQAEPA
FT                   EDLLNMEGMDRELAVELASRDIVTMEDLAEQAVDDLLEIEGLSEERAAELIMTARAPWF
FT                   EGEDEAGA"
     MLGCSPASIE YALKNFSLCK GLAMNKEILL VAETVSNEKG VSRDVIFEAI ELALAAATKK        60
     RFKQEDVEIR VDIDRESGNA RSFRVWHVVP DEELFEFGKQ LTLDEAHEQD TSLQIGDIWE       120
     EEVESEAFGR IAAQTAKQVI VQKVREAERR QIVEEYRDRI GDLVSGTVKK ASRDSIVLDL       180
     GGNAEALITR EHMIPREAVR QNDRVRAYLL GVNEENRGPQ LFASRACPDM LVELFKIEVP       240
     EIGEELIEIK GAARDPGSRA KIAVKTNDQR IDPVGACVGM RGARVQAVSN ELAGERIDIV       300
     LWDDNPAQLV INAMQPAEVA SIVMDEESHS MDIAVEDESA LAQAIGRSGQ NIRLASELTG       360
     WELNVMTIDD AESKQEQEAE QALQTFINEL EVDEDVAGVL VDEGFSTLEE VAYVPEEEML       420
     AIDGFDEEIV ELLRQRAKDA LLTKALVSEE KFDQAEPAED LLNMEGMDRE LAVELASRDI       480
     VTMEDLAEQA VDDLLEIEGL SEERAAELIM TARAPWFEGE DEAGA                       525
//

If you have problems or comments...

PBIL Back to PBIL home page