(data stored in ACNUC7421 zone)

EMBL: AM286690.OXYR

AM286690.OXYR        Location/Qualifiers
FT   CDS             complement(178689..179630)
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="ABO_0169"
FT                   /product="Activator of hydrogen peroxide-inducible genes
FT                   OxyR"
FT                   /function="Hydrogen peroxide sensor. Activates the
FT                   expression of a regulon of hydrogen peroxide-inducible
FT                   genes such as katG, gor, ahpC, ahpF, oxyS (a regulatory
FT                   RNA), dps, fur and grxA. oxyR expression is negatively
FT                   autoregulated by binding to a 43 bp region upstream of its
FT                   own coding sequence. oxyR is inactivated by reduction of
FT                   its essential disulfide bond by the product of grxA, itself
FT                   positively regulated by oxyR. Has also a positive
FT                   regulatory effect on the production of surface proteins
FT                   that control the colony morphology and auto-aggregation
FT                   ability."
FT                   /note="Hydrogen peroxide-inducible genes activator
FT                   (Morphology and auto-aggregation control protein).
FT                   (transcriptional regulator LysR family) identified by match
FT                   to PFAM protein family HMMPF03466"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15617"
FT                   /db_xref="GOA:Q0VTA3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTA3"
FT                   /inference="protein motif:HMMPFAM:HMMPF03466"
FT                   /protein_id="CAL15617.1"
FT                   /translation="MHNGIQSNKCINAMTLTELRYLVALARERHFGHAAQACNVSQPTL
FT                   SAAIKKLEEQLGMPLFERRPREVVVTPQAEPIIAQAQRVLEQADLLSQMAMSQRDQLGS
FT                   PLRVGAIFTVAPYLFPTMVPRVRKAAAEMPLFIEENYTHVLRRKLEHGELDAIIVALPF
FT                   SGGGLVRARMYEESFSVLLPADHPWTKQKKIAPEQLLSETLLLLGEGHCFRDQVLELCP
FT                   AIDSQHQRNLVQIEGGSLETLRHMVAGGLGITVLPNSALHQHGYDKHTFAVRPFEEPVP
FT                   SRTIALVWRDSFPRPKAIEVLRQAVPKEGLSG"
     MHNGIQSNKC INAMTLTELR YLVALARERH FGHAAQACNV SQPTLSAAIK KLEEQLGMPL        60
     FERRPREVVV TPQAEPIIAQ AQRVLEQADL LSQMAMSQRD QLGSPLRVGA IFTVAPYLFP       120
     TMVPRVRKAA AEMPLFIEEN YTHVLRRKLE HGELDAIIVA LPFSGGGLVR ARMYEESFSV       180
     LLPADHPWTK QKKIAPEQLL SETLLLLGEG HCFRDQVLEL CPAIDSQHQR NLVQIEGGSL       240
     ETLRHMVAGG LGITVLPNSA LHQHGYDKHT FAVRPFEEPV PSRTIALVWR DSFPRPKAIE       300
     VLRQAVPKEG LSG                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page