(data stored in ACNUC7421 zone)

EMBL: AM286690.PAND

AM286690.PAND        Location/Qualifiers
FT   CDS             complement(369808..370188)
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="ABO_0335"
FT                   /product="aspartate 1-decarboxylase"
FT                   /function="catalytic activity: l-aspartate = beta-alanine +
FT                   co(2). cofactor: pyruvoyl group (by similarity). pathway:
FT                   pantothenate biosynthesis; second branch. similarity
FT                   belongs to the pand family."
FT                   /EC_number="4.1.1.11"
FT                   /note="InterPro: Aspartate alpha-decarboxylase"
FT                   /note="High confidence in function and specificity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15783"
FT                   /db_xref="GOA:Q0VSR5"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VSR5"
FT                   /protein_id="CAL15783.1"
FT                   /translation="MQCTMLKAKLHQARVTHAELEYEGSCAIDGDLMDMAGILEYEQIQ
FT                   IYNIDNGERFETYAIRGEAGSKIISVNGAAAHKAQPGDRVIICAYANYTSAELINFKPS
FT                   LIYMAEGNEVKGTSNAIPVQVA"
     MQCTMLKAKL HQARVTHAEL EYEGSCAIDG DLMDMAGILE YEQIQIYNID NGERFETYAI        60
     RGEAGSKIIS VNGAAAHKAQ PGDRVIICAY ANYTSAELIN FKPSLIYMAE GNEVKGTSNA       120
     IPVQVA                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page