(data stored in ACNUC7421 zone)

EMBL: AM286690.PE101

AM286690.PE101       Location/Qualifiers
FT   CDS             complement(103811..104818)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0101"
FT                   /product="phospholipase"
FT                   /note="conserved hypothetical protein,"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15549"
FT                   /db_xref="GOA:Q0VTJ4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTJ4"
FT                   /protein_id="CAL15549.1"
FT                   /translation="MIDRDRLAILAAEESTSPRSGKPFRNRFATPHHGLGAFLRWQWDS
FT                   RGRFPAHQSFPLHRPDPEQLHKPGHRPQITWIGHATYLFQHHGWNLLTDPVFSDRCSPF
FT                   SFAGPKRAVPPALTVDQLPDINAVLISHNHYDHLDKASVKQLQKRFGRDILWFVPEGIA
FT                   PWLRKLGVERIIELGWWQSDYHGQVEAFCLPAQHFSGRGPNDHNQTLWCSWRLNFPDFS
FT                   LYFAGDTGYAPLFNEIAKVFGPVDLALLPIGAYEPRWFMSPVHINPAEAVKIHQDIQAR
FT                   QSLAMHWGTFVLTDEPMDAPPKALAKALSEQHIEHVHFQVPQHGETLTIELTHE"
     MIDRDRLAIL AAEESTSPRS GKPFRNRFAT PHHGLGAFLR WQWDSRGRFP AHQSFPLHRP        60
     DPEQLHKPGH RPQITWIGHA TYLFQHHGWN LLTDPVFSDR CSPFSFAGPK RAVPPALTVD       120
     QLPDINAVLI SHNHYDHLDK ASVKQLQKRF GRDILWFVPE GIAPWLRKLG VERIIELGWW       180
     QSDYHGQVEA FCLPAQHFSG RGPNDHNQTL WCSWRLNFPD FSLYFAGDTG YAPLFNEIAK       240
     VFGPVDLALL PIGAYEPRWF MSPVHINPAE AVKIHQDIQA RQSLAMHWGT FVLTDEPMDA       300
     PPKALAKALS EQHIEHVHFQ VPQHGETLTI ELTHE                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page