(data stored in ACNUC7421 zone)

EMBL: AM286690.PE115

AM286690.PE115       Location/Qualifiers
FT   CDS             122402..123412
FT                   /transl_table=11
FT                   /locus_tag="ABO_0115"
FT                   /product="transcriptional regulator"
FT                   /note="transcriptional regulator AraC family identified by
FT                   match to PFAM protein family HMMPF00165 InterPro: AraC type
FT                   helix-turn-helix"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15563"
FT                   /db_xref="GOA:Q0VTI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTI0"
FT                   /inference="protein motif:HMMPFAM:HMMPF00165"
FT                   /protein_id="CAL15563.1"
FT                   /translation="MATAMRVTGAWVQLLTDWLDRENLPAPTLRAVLDSRSPADLVPLP
FT                   LWRDLLQQAVALRPERLAPGLEIGALIQPRHVGMLGYLILTCRTLGEAMLAYQRYETLF
FT                   YGQDMVEAVGEGDQILVRWPGEITTGELADSVAIAALISFLRRQVDAPPVPAQVAFAFA
FT                   APAAPVRAAYEAFFGCEVVFEQAHTCVAFPVHFLAIALPHSDPSMRSLLDRQAQAMLSA
FT                   LPGSGSFDRALQHAMVRLMPEAAVTLPRLAAELHMSVRTLQRRLTQRQLTWRELLDRTR
FT                   EQLARHYLADRSLTLGDIALLLGFSEHSAFSRAYRRWTGTTPARTRKQMGEAYKP"
     MATAMRVTGA WVQLLTDWLD RENLPAPTLR AVLDSRSPAD LVPLPLWRDL LQQAVALRPE        60
     RLAPGLEIGA LIQPRHVGML GYLILTCRTL GEAMLAYQRY ETLFYGQDMV EAVGEGDQIL       120
     VRWPGEITTG ELADSVAIAA LISFLRRQVD APPVPAQVAF AFAAPAAPVR AAYEAFFGCE       180
     VVFEQAHTCV AFPVHFLAIA LPHSDPSMRS LLDRQAQAML SALPGSGSFD RALQHAMVRL       240
     MPEAAVTLPR LAAELHMSVR TLQRRLTQRQ LTWRELLDRT REQLARHYLA DRSLTLGDIA       300
     LLLGFSEHSA FSRAYRRWTG TTPARTRKQM GEAYKP                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page