(data stored in ACNUC7421 zone)

EMBL: AM286690.PE118

AM286690.PE118       Location/Qualifiers
FT   CDS             125579..126451
FT                   /transl_table=11
FT                   /locus_tag="ABO_0118"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="transcriptional regulator LysR family identified by
FT                   match to PFAM protein family HMMPF03466 InterPro: Bacterial
FT                   regulatory protein LysR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15566"
FT                   /db_xref="GOA:Q0VTH7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTH7"
FT                   /inference="protein motif:HMMPFAM:HMMPF03466"
FT                   /protein_id="CAL15566.1"
FT                   /translation="MQHWDRIEAFVEVVRGGSFARAARHLGVSSSHVSRLVARLETQLG
FT                   TQLLYRTTRRLTLTDAGTVYFEHCCQLFDGFQEALNAISDFQQQPTGVLRLTCATTFGE
FT                   RFIAPLVNDFLARHPQLSVQLDFTNRRVDIVDEGFDVAIRTGALPDSSLIARKLCPRRE
FT                   YVVGSPGYFSRHARPHTLGELSGHNCLQGSSEQWTFDVDGQHRHSKVQGNWKGNSGAAL
FT                   LDAARKGIGLAQLPDYYVGEDLARGQLVSVLDQYACTHTAVWVVYPRHRHLSPKVRQCV
FT                   DFLVEKMGR"
     MQHWDRIEAF VEVVRGGSFA RAARHLGVSS SHVSRLVARL ETQLGTQLLY RTTRRLTLTD        60
     AGTVYFEHCC QLFDGFQEAL NAISDFQQQP TGVLRLTCAT TFGERFIAPL VNDFLARHPQ       120
     LSVQLDFTNR RVDIVDEGFD VAIRTGALPD SSLIARKLCP RREYVVGSPG YFSRHARPHT       180
     LGELSGHNCL QGSSEQWTFD VDGQHRHSKV QGNWKGNSGA ALLDAARKGI GLAQLPDYYV       240
     GEDLARGQLV SVLDQYACTH TAVWVVYPRH RHLSPKVRQC VDFLVEKMGR                  290
//

If you have problems or comments...

PBIL Back to PBIL home page