(data stored in ACNUC7421 zone)

EMBL: AM286690.PE123

AM286690.PE123       Location/Qualifiers
FT   CDS             complement(131644..132744)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0123"
FT                   /product="fimbrial protein"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15571"
FT                   /db_xref="GOA:Q0VTH2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTH2"
FT                   /protein_id="CAL15571.1"
FT                   /translation="MIRLLLAIMGVLFMGLFSHSASAVGFCLNGPFDQNIVFQRSSGSV
FT                   AIPGDSSDSYSVVIEETSTYTGCISVGVIPTIYSEINSPFTNTGNFPPPSSVSLPAGFS
FT                   SQTASRLQVSSGIHLQTFYAIEKGPFTRYCGLNGNVCSGALLSLDVLSSITFHTYTVIT
FT                   FGTMNSFIGSSISQSGGIGRMEINTGLLGRINVDISATINYIFTRSSCDLATPSQTVTL
FT                   DPAMASSLTPGSYVSATPFDIQLVNCVPPRSLSDSGNSFSGSLIRVAFLPASGQLVAGS
FT                   TTDLRPLDQGMPGVAEGVAFQLRQRNTATPVTLDGQTTLTAPLGTRNPADTTETFELEA
FT                   GLVKVNGETVTAGNVSSAVTFEVEYR"
     MIRLLLAIMG VLFMGLFSHS ASAVGFCLNG PFDQNIVFQR SSGSVAIPGD SSDSYSVVIE        60
     ETSTYTGCIS VGVIPTIYSE INSPFTNTGN FPPPSSVSLP AGFSSQTASR LQVSSGIHLQ       120
     TFYAIEKGPF TRYCGLNGNV CSGALLSLDV LSSITFHTYT VITFGTMNSF IGSSISQSGG       180
     IGRMEINTGL LGRINVDISA TINYIFTRSS CDLATPSQTV TLDPAMASSL TPGSYVSATP       240
     FDIQLVNCVP PRSLSDSGNS FSGSLIRVAF LPASGQLVAG STTDLRPLDQ GMPGVAEGVA       300
     FQLRQRNTAT PVTLDGQTTL TAPLGTRNPA DTTETFELEA GLVKVNGETV TAGNVSSAVT       360
     FEVEYR                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page