(data stored in ACNUC7421 zone)

EMBL: AM286690.PE13

AM286690.PE13        Location/Qualifiers
FT   CDS             14888..16369
FT                   /transl_table=11
FT                   /locus_tag="ABO_0013"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15461"
FT                   /db_xref="GOA:Q0VT18"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT18"
FT                   /protein_id="CAL15461.1"
FT                   /translation="MDDKGKTENLDGRCTGIAEPRFAVVGHPNKGKSSVVATLAQNDSI
FT                   AIAMEPGTTRDSHRYPMKVDDVTLYELIDTPGFQRPRKVLAWLQGHSLSASDRPDTVAA
FT                   FVTQHRDDPRYHDECELLRPIVEGAGIIYVVDGSVPYNREHEAEMNILRWTGRPSLALI
FT                   NQIGPDDHSAAWEAALGQYFQIVRRFDAVGAPFEKHLDLLRSFGQLAPHWREPLDAALE
FT                   YLQALKFGRDSQALECIADALIGMLGHQETARLGEFESAEPLLPKLQQRWQAWQREREQ
FT                   RLRGAVEDLYQHRRLQRQEDTLVTPEGGDLFSERTRQLWGISKNQLAAAGFGAGAVGGA
FT                   GIDAMALGHSLGAGALIGGLLGAAGSYYYSGKLTKLKFGPLSGGFREAVYGPLRDPQFA
FT                   YVVLGRALVHWYQVSQRNHAGRDVLVVTGADDHWLGQMERSHRNGLQKSLQALAQRRFE
FT                   PSKRQRLIEQLEWAQQAFAQWQLQAFQTTDETTTD"
     MDDKGKTENL DGRCTGIAEP RFAVVGHPNK GKSSVVATLA QNDSIAIAME PGTTRDSHRY        60
     PMKVDDVTLY ELIDTPGFQR PRKVLAWLQG HSLSASDRPD TVAAFVTQHR DDPRYHDECE       120
     LLRPIVEGAG IIYVVDGSVP YNREHEAEMN ILRWTGRPSL ALINQIGPDD HSAAWEAALG       180
     QYFQIVRRFD AVGAPFEKHL DLLRSFGQLA PHWREPLDAA LEYLQALKFG RDSQALECIA       240
     DALIGMLGHQ ETARLGEFES AEPLLPKLQQ RWQAWQRERE QRLRGAVEDL YQHRRLQRQE       300
     DTLVTPEGGD LFSERTRQLW GISKNQLAAA GFGAGAVGGA GIDAMALGHS LGAGALIGGL       360
     LGAAGSYYYS GKLTKLKFGP LSGGFREAVY GPLRDPQFAY VVLGRALVHW YQVSQRNHAG       420
     RDVLVVTGAD DHWLGQMERS HRNGLQKSLQ ALAQRRFEPS KRQRLIEQLE WAQQAFAQWQ       480
     LQAFQTTDET TTD                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page