(data stored in ACNUC7421 zone)

EMBL: AM286690.PE132

AM286690.PE132       Location/Qualifiers
FT   CDS             142994..144067
FT                   /transl_table=11
FT                   /locus_tag="ABO_0132"
FT                   /product="LysM domain protein"
FT                   /function="may have a general peptidoglycan binding
FT                   function"
FT                   /note="Region start changed from 142733 to 142994 (-261
FT                   bases)"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15580"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTE0"
FT                   /protein_id="CAL15580.1"
FT                   /translation="MMMKSVQRALTFGLVLAVSGMASAAVVLKDGHPSKYFVKNGDTLW
FT                   DISGRFLQEPWQWPEIWQINEEISNPHLIYPGDEIRLSYVDGEPRLSVKRGVEETVMSN
FT                   GTVKLTPRVREIANDQAIPAIPASAIQSYLKEGLVVDRQEIIEAPYLVGGRDRRVIFGE
FT                   GDTVYARDTKTQWEGLEQGYGFYRTGEQYVDPDTNEVLGYEARQIGLGRVSSHDDDMIS
FT                   LRVTDSSEDLRIDDRLFSTEDRRVRAVLYPSAPDTKIEAKVIRFFDRLNSVARNDVVVI
FT                   NKGLRDGLKEGNVLDIYGQGEVVRDRQQGDMVQLPRERTGSMVIFRVFDKVSYSLIMES
FT                   TRPIYMNDIAESPAGSY"
     MMMKSVQRAL TFGLVLAVSG MASAAVVLKD GHPSKYFVKN GDTLWDISGR FLQEPWQWPE        60
     IWQINEEISN PHLIYPGDEI RLSYVDGEPR LSVKRGVEET VMSNGTVKLT PRVREIANDQ       120
     AIPAIPASAI QSYLKEGLVV DRQEIIEAPY LVGGRDRRVI FGEGDTVYAR DTKTQWEGLE       180
     QGYGFYRTGE QYVDPDTNEV LGYEARQIGL GRVSSHDDDM ISLRVTDSSE DLRIDDRLFS       240
     TEDRRVRAVL YPSAPDTKIE AKVIRFFDRL NSVARNDVVV INKGLRDGLK EGNVLDIYGQ       300
     GEVVRDRQQG DMVQLPRERT GSMVIFRVFD KVSYSLIMES TRPIYMNDIA ESPAGSY          357
//

If you have problems or comments...

PBIL Back to PBIL home page