(data stored in ACNUC7421 zone)

EMBL: AM286690.PE134

AM286690.PE134       Location/Qualifiers
FT   CDS             145289..145837
FT                   /transl_table=11
FT                   /locus_tag="ABO_0134"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /function="Putative translation factor, this domain has
FT                   been shown to preferentially bind to dsRNA"
FT                   /note="identified by match to TIGR protein family
FT                   HMMTIGR00057 InterPro: Sua5/YciO/YrdC/YwlC protein family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15582"
FT                   /db_xref="GOA:Q0VTD8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VTD8"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR00057"
FT                   /protein_id="CAL15582.1"
FT                   /translation="MNQHLLSAAQIIQEGGVVAYPTESVYGLGCDPFNRNAVMQLLAIK
FT                   HRPVSKGLILIGESLAQLAPYLHLNEQQSAQLEKKWPAPITYLVDASDRLPAWVRGEHR
FT                   KVAVRVPDHPLARQLCQLAGQPIISTSANISGRPAARNRYQVARQLGNQLDFIVSGACD
FT                   RAAKPSTIIDLESGRILRP"
     MNQHLLSAAQ IIQEGGVVAY PTESVYGLGC DPFNRNAVMQ LLAIKHRPVS KGLILIGESL        60
     AQLAPYLHLN EQQSAQLEKK WPAPITYLVD ASDRLPAWVR GEHRKVAVRV PDHPLARQLC       120
     QLAGQPIIST SANISGRPAA RNRYQVARQL GNQLDFIVSG ACDRAAKPST IIDLESGRIL       180
     RP                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page