(data stored in ACNUC7421 zone)

EMBL: AM286690.PE137

AM286690.PE137       Location/Qualifiers
FT   CDS             147633..148061
FT                   /transl_table=11
FT                   /locus_tag="ABO_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="(conserved hypothetical protein, Kef-type K+
FT                   transport systems, predicted NAD-binding component)
FT                   identified by sequencesimilarity; putative InterPro:
FT                   Potassium channel"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15585"
FT                   /db_xref="GOA:Q0VTD5"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTD5"
FT                   /protein_id="CAL15585.1"
FT                   /translation="MYEVVYASVVSLIMVLATVMLHYWTLASLSGLLKRWKSFRGEILV
FT                   VVIVMFAAHMVEITLYAWVYLLLDVGDTAMSIGGAVNGSFLDHLYFSAACYTSLGLGDL
FT                   FPVGTLRLIAGVEALNGLILITWSASFAFLVMQRRWRF"
     MYEVVYASVV SLIMVLATVM LHYWTLASLS GLLKRWKSFR GEILVVVIVM FAAHMVEITL        60
     YAWVYLLLDV GDTAMSIGGA VNGSFLDHLY FSAACYTSLG LGDLFPVGTL RLIAGVEALN       120
     GLILITWSAS FAFLVMQRRW RF                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page