(data stored in ACNUC7421 zone)

EMBL: AM286690.PE138

AM286690.PE138       Location/Qualifiers
FT   CDS             148125..149105
FT                   /transl_table=11
FT                   /locus_tag="ABO_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="(Uncharacterized protein conserved in bacteria,
FT                   COG3528)"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15586"
FT                   /db_xref="InterPro:IPR018707"
FT                   /db_xref="InterPro:IPR037107"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTD4"
FT                   /protein_id="CAL15586.1"
FT                   /translation="MFLRFILLLGVLLPVSVIASTFGLSWDNDLFVGSDGHYTNGVRIS
FT                   WVGEAHDHCESNSNVTCGVADFLSPLPGIAFRDDQHALTFSLEQMMITPKDISQSAPNY
FT                   NDLPYAGYSNLEMGLFSWDDDSLVGYGMRLGVVGPSSGAEQSQKLAHKVTGSDEPQGWD
FT                   NQLGTDLIGGLYFINARRFKQFQWDSALQGELGYAWGVDANNFHGTSSAGGFFRVGHNL
FT                   PRNFIPDYAGIGTAGSLVGLFDGTGFGWEVFISTFGEYIGYSYLETHARQYNVETRDGV
FT                   LGVTAGGGVHWDTFSFTLAIQSSTSPLRSRDESASFGNMSFMWKI"
     MFLRFILLLG VLLPVSVIAS TFGLSWDNDL FVGSDGHYTN GVRISWVGEA HDHCESNSNV        60
     TCGVADFLSP LPGIAFRDDQ HALTFSLEQM MITPKDISQS APNYNDLPYA GYSNLEMGLF       120
     SWDDDSLVGY GMRLGVVGPS SGAEQSQKLA HKVTGSDEPQ GWDNQLGTDL IGGLYFINAR       180
     RFKQFQWDSA LQGELGYAWG VDANNFHGTS SAGGFFRVGH NLPRNFIPDY AGIGTAGSLV       240
     GLFDGTGFGW EVFISTFGEY IGYSYLETHA RQYNVETRDG VLGVTAGGGV HWDTFSFTLA       300
     IQSSTSPLRS RDESASFGNM SFMWKI                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page