(data stored in ACNUC7421 zone)

EMBL: AM286690.PE139

AM286690.PE139       Location/Qualifiers
FT   CDS             complement(149202..149741)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0139"
FT                   /product="anhydrase, family 3 protein"
FT                   /note="identified by sequencesimilarity; putative InterPro:
FT                   Bacterial transferase hexapeptide repeat"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15587"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTD3"
FT                   /protein_id="CAL15587.1"
FT                   /translation="MMGIRRFEDKAPQLGKRVFVDEDATVIGEVILGDDCSVWPKAVIR
FT                   GDMHAIRIGNRVSIQDNAVLHITHDSPFNPGGFGLQVGDDVTLAHQAMLHGCTLGNRVM
FT                   VGMQAIIMDGAIVEDDVIVAAGSLVGPGKNLESGHLYRGQPARKIRPLTEKEKTFLPYV
FT                   AGNYVRLKDRYLKSSQ"
     MMGIRRFEDK APQLGKRVFV DEDATVIGEV ILGDDCSVWP KAVIRGDMHA IRIGNRVSIQ        60
     DNAVLHITHD SPFNPGGFGL QVGDDVTLAH QAMLHGCTLG NRVMVGMQAI IMDGAIVEDD       120
     VIVAAGSLVG PGKNLESGHL YRGQPARKIR PLTEKEKTFL PYVAGNYVRL KDRYLKSSQ        179
//

If you have problems or comments...

PBIL Back to PBIL home page