(data stored in ACNUC7421 zone)

EMBL: AM286690.PE14

AM286690.PE14        Location/Qualifiers
FT   CDS             16498..17004
FT                   /transl_table=11
FT                   /locus_tag="ABO_0014"
FT                   /product="transcriptional regulator, MarR family"
FT                   /function="regulation of transcription, DNA-dependent"
FT                   /note="transcriptional regulator MarR family identified by
FT                   sequencesimilarity; putative InterPro: Bacterial regulatory
FT                   protein MarR family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15462"
FT                   /db_xref="GOA:Q0VT17"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT17"
FT                   /protein_id="CAL15462.1"
FT                   /translation="MTRFDATENRISLTHKRFPAYPREPAMLVRLMKAISQHVHDSANV
FT                   LLREYGLNHTDYNVLMMLYGCEQQGMTVTQLRDAAAEKSANVTRVCNILCERGWIARFA
FT                   DPQDRRRVLVSLTTEGEKLVEQFLPSMASLLNQYGAAFDAQEIAVLETLLKRLLGVAEQ
FT                   IERNL"
     MTRFDATENR ISLTHKRFPA YPREPAMLVR LMKAISQHVH DSANVLLREY GLNHTDYNVL        60
     MMLYGCEQQG MTVTQLRDAA AEKSANVTRV CNILCERGWI ARFADPQDRR RVLVSLTTEG       120
     EKLVEQFLPS MASLLNQYGA AFDAQEIAVL ETLLKRLLGV AEQIERNL                    168
//

If you have problems or comments...

PBIL Back to PBIL home page