(data stored in ACNUC7421 zone)

EMBL: AM286690.PE149

AM286690.PE149       Location/Qualifiers
FT   CDS             complement(159505..159921)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0149"
FT                   /product="conserved hypothetical protein"
FT                   /function="unkown"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15597"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC3"
FT                   /protein_id="CAL15597.1"
FT                   /translation="MAEPLGLFPMIPNPNDTYLVYDGECPACRNYVRFIRFRNTIGPLH
FT                   LIDARQAPQWVAHMQEKGISLDDGMVLLLNGHYLHGADAVHHIALLSSPSGLFNCINAF
FT                   VFRSRKLSRCLYPVLKICRNTLLFLMGKKPLNTH"
     MAEPLGLFPM IPNPNDTYLV YDGECPACRN YVRFIRFRNT IGPLHLIDAR QAPQWVAHMQ        60
     EKGISLDDGM VLLLNGHYLH GADAVHHIAL LSSPSGLFNC INAFVFRSRK LSRCLYPVLK       120
     ICRNTLLFLM GKKPLNTH                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page