(data stored in ACNUC7421 zone)

EMBL: AM286690.PE152

AM286690.PE152       Location/Qualifiers
FT   CDS             complement(161394..161603)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTC0"
FT                   /protein_id="CAL15600.1"
FT                   /translation="MHSPEHLSDRELVMKKLTYATLALAIFAGAAIVSEVPLVDEARAE
FT                   CSSIWASCSESETSELQSELDNAG"
     MHSPEHLSDR ELVMKKLTYA TLALAIFAGA AIVSEVPLVD EARAECSSIW ASCSESETSE        60
     LQSELDNAG                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page