(data stored in ACNUC7421 zone)

EMBL: AM286690.PE174

AM286690.PE174       Location/Qualifiers
FT   CDS             complement(183370..183606)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="conserved hypothetical protein, Similar to pspto3478
FT                   from Pseudomonas syringae (pv. tomato)"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15622"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT98"
FT                   /protein_id="CAL15622.1"
FT                   /translation="MDTATRDLNTLFDQLGLASSDHDIEDFIHQHGGTLADSMHLHQAP
FT                   FWNESQSKFLVEAVREDAEWAETVDTLSALLRH"
     MDTATRDLNT LFDQLGLASS DHDIEDFIHQ HGGTLADSMH LHQAPFWNES QSKFLVEAVR        60
     EDAEWAETVD TLSALLRH                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page