(data stored in ACNUC7421 zone)

EMBL: AM286690.PE179

AM286690.PE179       Location/Qualifiers
FT   CDS             187994..188983
FT                   /transl_table=11
FT                   /locus_tag="ABO_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15627"
FT                   /db_xref="GOA:Q0VT93"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR014336"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT93"
FT                   /protein_id="CAL15627.1"
FT                   /translation="MQDSAISATVDFHQDGVQHGFLKLPYSHDQSAWGNVMIPITVICN
FT                   GEGPTALLTGGNHGDEYEGITALLKLANRLGAEEISGRVIIVPMMNHPAVLNGTRTSPL
FT                   DGGNLNRAFPGNPVGTLTEKIADYFTRYLVPLADVVLDMHSGGRTLDLLPFAATHRLAD
FT                   ATFGARCLAGAQAFGAPYTLFMAELEEAALFDSVVESLGRVFISTELRGGGTTTPGTVA
FT                   LAEQGVDNVLRFAGILPGDPLPVASQALEIPSADYYRVSQHRGLLEFAVELGDWVQQGD
FT                   VLARVYSLERTGEPPVDYRAPFAGMLIGRRHPARVDVGDTFAVLAVKR"
     MQDSAISATV DFHQDGVQHG FLKLPYSHDQ SAWGNVMIPI TVICNGEGPT ALLTGGNHGD        60
     EYEGITALLK LANRLGAEEI SGRVIIVPMM NHPAVLNGTR TSPLDGGNLN RAFPGNPVGT       120
     LTEKIADYFT RYLVPLADVV LDMHSGGRTL DLLPFAATHR LADATFGARC LAGAQAFGAP       180
     YTLFMAELEE AALFDSVVES LGRVFISTEL RGGGTTTPGT VALAEQGVDN VLRFAGILPG       240
     DPLPVASQAL EIPSADYYRV SQHRGLLEFA VELGDWVQQG DVLARVYSLE RTGEPPVDYR       300
     APFAGMLIGR RHPARVDVGD TFAVLAVKR                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page