(data stored in ACNUC7421 zone)

EMBL: AM286690.PE182

AM286690.PE182       Location/Qualifiers
FT   CDS             191778..192758
FT                   /transl_table=11
FT                   /locus_tag="ABO_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15630"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT90"
FT                   /protein_id="CAL15630.1"
FT                   /translation="MSGAEYHKHTHRPGRHCGSSAIRDLLEFHGLNLTEAFCFGLGAGL
FT                   GITYVEIPNSDTPFIVHVRSMGFEEAVFSTLGVPFHWESWQDKEDAAKALDGYLDAGRP
FT                   ALLLTDIYHLPYFKSSTHFPGHAIVAWQRTDDGKTVLVSDTERPELLEVPRDKLALARF
FT                   SLTPPFIHHGSLFAPEDISVEISPEQVKSAIIRNAQTLKDGDKNQGIEALNTWINDLHR
FT                   WKDFEKWPWLLRFAYQVIEKRGTGGGGFRTMYAEFIDEAEEVIPALKKMGLSDLMRDSA
FT                   SAWSALADCLRLGSESETFPTEMIREAIAKVREAELRYIDAALTL"
     MSGAEYHKHT HRPGRHCGSS AIRDLLEFHG LNLTEAFCFG LGAGLGITYV EIPNSDTPFI        60
     VHVRSMGFEE AVFSTLGVPF HWESWQDKED AAKALDGYLD AGRPALLLTD IYHLPYFKSS       120
     THFPGHAIVA WQRTDDGKTV LVSDTERPEL LEVPRDKLAL ARFSLTPPFI HHGSLFAPED       180
     ISVEISPEQV KSAIIRNAQT LKDGDKNQGI EALNTWINDL HRWKDFEKWP WLLRFAYQVI       240
     EKRGTGGGGF RTMYAEFIDE AEEVIPALKK MGLSDLMRDS ASAWSALADC LRLGSESETF       300
     PTEMIREAIA KVREAELRYI DAALTL                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page