(data stored in ACNUC7421 zone)

EMBL: AM286690.PE188

AM286690.PE188       Location/Qualifiers
FT   CDS             complement(200034..200918)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0188"
FT                   /product="predicted metal hydrolase, putative"
FT                   /note="predicted metal-dependent hydrolase"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15636"
FT                   /db_xref="GOA:Q0VT84"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT84"
FT                   /protein_id="CAL15636.1"
FT                   /translation="MRSSNPVKSIKKLSGALVGIPPRHINFSFPENMPKYFYAGNATAT
FT                   TFFAMLSGFFPPGERYFMESVRHFRNEVKDETLRAEISGFMGQEAIHGREHDRLNNILS
FT                   EYGFDMQAPDRFVKIGLAILEKLPPSTRLAATTFMEHFTALLAEQLLNDEQFVQQADPE
FT                   MIKIWQWHALEELEHKSVAYDVYELIGNSRIERAAAALASVVVLLPMLGVTWSWMLAKD
FT                   GQLGNLKDNIKGLNVLLGRNGFVSRILSRLPEFVEPNFHPNQHNTKQLESNWRDKLFAV
FT                   GGALHDQYSNSAA"
     MRSSNPVKSI KKLSGALVGI PPRHINFSFP ENMPKYFYAG NATATTFFAM LSGFFPPGER        60
     YFMESVRHFR NEVKDETLRA EISGFMGQEA IHGREHDRLN NILSEYGFDM QAPDRFVKIG       120
     LAILEKLPPS TRLAATTFME HFTALLAEQL LNDEQFVQQA DPEMIKIWQW HALEELEHKS       180
     VAYDVYELIG NSRIERAAAA LASVVVLLPM LGVTWSWMLA KDGQLGNLKD NIKGLNVLLG       240
     RNGFVSRILS RLPEFVEPNF HPNQHNTKQL ESNWRDKLFA VGGALHDQYS NSAA             294
//

If you have problems or comments...

PBIL Back to PBIL home page