(data stored in ACNUC7421 zone)

EMBL: AM286690.PE189

AM286690.PE189       Location/Qualifiers
FT   CDS             complement(200959..201825)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0189"
FT                   /product="short chain dehydrogenase, putative"
FT                   /EC_number="1.1.1.-"
FT                   /note="oxidoreductase short chaindehydrogenase/reductase
FT                   family identified by sequence similarity; putative
FT                   InterPro: Short-chain dehydrogenase/reductase (SDR)
FT                   superfamily"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15637"
FT                   /db_xref="GOA:Q0VT83"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT83"
FT                   /protein_id="CAL15637.1"
FT                   /translation="MKSFSGKVAAITGAGSGIGQATAIALAKKGCHLAISDISQESLEK
FT                   TIKMLAHYPVKVSSHVVDVSDREAVYKYADDTVTEHGKVNIIMNNAGVGLGETVENMSY
FT                   ENFEWLMNINFWGVVYGTKAFLPHLKRADEGHIINISSVFGIIGVPTQSAYNAAKFAVR
FT                   GFTESLREELDIEGGRVSATSVHPGGVKTNIARNSRMGDMGDMGIGDKEDIADMFEKIA
FT                   MTTPETAAKTILKAVRKNRRRVLVGGDAIMLDTTQRLMPTGYQRLLEVMFKKQQGKNSK
FT                   TARKGIA"
     MKSFSGKVAA ITGAGSGIGQ ATAIALAKKG CHLAISDISQ ESLEKTIKML AHYPVKVSSH        60
     VVDVSDREAV YKYADDTVTE HGKVNIIMNN AGVGLGETVE NMSYENFEWL MNINFWGVVY       120
     GTKAFLPHLK RADEGHIINI SSVFGIIGVP TQSAYNAAKF AVRGFTESLR EELDIEGGRV       180
     SATSVHPGGV KTNIARNSRM GDMGDMGIGD KEDIADMFEK IAMTTPETAA KTILKAVRKN       240
     RRRVLVGGDA IMLDTTQRLM PTGYQRLLEV MFKKQQGKNS KTARKGIA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page