(data stored in ACNUC7421 zone)

EMBL: AM286690.PE194

AM286690.PE194       Location/Qualifiers
FT   CDS             complement(210379..211977)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0194"
FT                   /product="monooxygenase"
FT                   /note="monooxygenase flavin-binding family (oxydoreductase
FT                   with NADH or NADPH as one donor, and incorporation of one
FT                   atom of oxygen) identified by sequence similarity; putative
FT                   InterPro: Flavin-containing monooxygenase (FMO)"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15642"
FT                   /db_xref="GOA:Q0VT78"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT78"
FT                   /protein_id="CAL15642.1"
FT                   /translation="MNMAAFATQNPRYNISPDHEVIIIGAGISGIGAAIQLRADGIKDI
FT                   LILERSEDVGGTWRDNRYPGIAVDISSFTYSFSFEQNANWSRVFAPGNELYQYTRQVTS
FT                   KYGIYPLIRFGVEVTRASFDLANHLWVLELGDGRQLRARHIVSACGGLISPKMPDIEGL
FT                   EKFQGEVIHTARWPDDLDLSDKRVAVIGTGATAVQLLPEIAVKARQLDVYQRTPIWVLK
FT                   KPDHTLPGWLKSLFRTVPGLQRTLRGATDTASETLMVLSTIYYRQAPWLVRMCEKAGIA
FT                   NMRKQLPNRKDLWEKLTPKYGFGCKRPTFSNEYFRTFARDNVELVTTPIKHITSSGITT
FT                   DDGRSRRIDTLILATGYKTFEKGNIPSFDVIGSNSINLGDFWHDHRYQAYEGLTIPGYP
FT                   NFYIMLGPYALIGTSYFKMVEGNAIHLSRCIREANRRGATQVEIRQSVHDDYFRNIQKR
FT                   QQNTVFLNHNCAQSNSYYFDHHGDAPMLRPSTSLEMLWRAKHLPMNHYQFSRLGDHPNP
FT                   TTPSTVESKRVSRIP"
     MNMAAFATQN PRYNISPDHE VIIIGAGISG IGAAIQLRAD GIKDILILER SEDVGGTWRD        60
     NRYPGIAVDI SSFTYSFSFE QNANWSRVFA PGNELYQYTR QVTSKYGIYP LIRFGVEVTR       120
     ASFDLANHLW VLELGDGRQL RARHIVSACG GLISPKMPDI EGLEKFQGEV IHTARWPDDL       180
     DLSDKRVAVI GTGATAVQLL PEIAVKARQL DVYQRTPIWV LKKPDHTLPG WLKSLFRTVP       240
     GLQRTLRGAT DTASETLMVL STIYYRQAPW LVRMCEKAGI ANMRKQLPNR KDLWEKLTPK       300
     YGFGCKRPTF SNEYFRTFAR DNVELVTTPI KHITSSGITT DDGRSRRIDT LILATGYKTF       360
     EKGNIPSFDV IGSNSINLGD FWHDHRYQAY EGLTIPGYPN FYIMLGPYAL IGTSYFKMVE       420
     GNAIHLSRCI REANRRGATQ VEIRQSVHDD YFRNIQKRQQ NTVFLNHNCA QSNSYYFDHH       480
     GDAPMLRPST SLEMLWRAKH LPMNHYQFSR LGDHPNPTTP STVESKRVSR IP               532
//

If you have problems or comments...

PBIL Back to PBIL home page