(data stored in ACNUC7421 zone)

EMBL: AM286690.PE197

AM286690.PE197       Location/Qualifiers
FT   CDS             complement(213808..214740)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0197"
FT                   /product="metal-dependent hydrolase, putative"
FT                   /note="predicted metal-dependent hydrolase"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15645"
FT                   /db_xref="GOA:Q0VT75"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT75"
FT                   /protein_id="CAL15645.1"
FT                   /translation="MALANRKIGYDEVVTRDIHFPMNIENVARHWFGNDPWSTHWMNAI
FT                   LAAVPDGERWVMNSARRQLSKLDDPEVLNAAKEFIRQERIHAREHDEMNAIGVQHGVPI
FT                   DKVEGVFKLIRKQLQHRLSDDMQSSIAAAFEHFTAIISSVLLEHPELFDETHPELRAML
FT                   YWHFVEETEHKSVSYDVFVDASGGGFRSYRLRASGMLLAIALGFPLMIGNQTYLLYKDR
FT                   QILNLRSAAKMTKVLFWRPGILSKVLGGVTPYFSPTFHPWDDDNRDVIRIWKRAYEKTG
FT                   DAQKAYQALRDHRAKHAPETLSAPQAEPA"
     MALANRKIGY DEVVTRDIHF PMNIENVARH WFGNDPWSTH WMNAILAAVP DGERWVMNSA        60
     RRQLSKLDDP EVLNAAKEFI RQERIHAREH DEMNAIGVQH GVPIDKVEGV FKLIRKQLQH       120
     RLSDDMQSSI AAAFEHFTAI ISSVLLEHPE LFDETHPELR AMLYWHFVEE TEHKSVSYDV       180
     FVDASGGGFR SYRLRASGML LAIALGFPLM IGNQTYLLYK DRQILNLRSA AKMTKVLFWR       240
     PGILSKVLGG VTPYFSPTFH PWDDDNRDVI RIWKRAYEKT GDAQKAYQAL RDHRAKHAPE       300
     TLSAPQAEPA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page