(data stored in ACNUC7421 zone)

EMBL: AM286690.PE204

AM286690.PE204       Location/Qualifiers
FT   CDS             222489..223181
FT                   /transl_table=11
FT                   /locus_tag="ABO_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15652"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT68"
FT                   /protein_id="CAL15652.1"
FT                   /translation="MQVAAMDFEAALQPSEYIDSDSPSVISFAETVVGDETDPIKKAVK
FT                   LYYAVRDDIRYDPYRICFSQEGLKASTTLANGYGYCVAKAVLLAAAGRAVGIPCRLGFA
FT                   DVKNHLSSEKLKEMMQTDVFAWHGYTELYIDTRWVKATPAFNQSLCDKTGVKPLEFDGI
FT                   HDSVLHAFDQAGNRHMEYLKEHGVFDDLPFQQILADFKKYYPAFKGLFGSSAAVAVEGR
FT                   FEDEASAG"
     MQVAAMDFEA ALQPSEYIDS DSPSVISFAE TVVGDETDPI KKAVKLYYAV RDDIRYDPYR        60
     ICFSQEGLKA STTLANGYGY CVAKAVLLAA AGRAVGIPCR LGFADVKNHL SSEKLKEMMQ       120
     TDVFAWHGYT ELYIDTRWVK ATPAFNQSLC DKTGVKPLEF DGIHDSVLHA FDQAGNRHME       180
     YLKEHGVFDD LPFQQILADF KKYYPAFKGL FGSSAAVAVE GRFEDEASAG                  230
//

If you have problems or comments...

PBIL Back to PBIL home page