(data stored in ACNUC7421 zone)

EMBL: AM286690.PE208

AM286690.PE208       Location/Qualifiers
FT   CDS             225878..226510
FT                   /transl_table=11
FT                   /locus_tag="ABO_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15656"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT64"
FT                   /protein_id="CAL15656.1"
FT                   /translation="MRIVVLLMAFILVSPLLPSSVWARSGQRANERMPDGAYFRHETTD
FT                   GVVHLNRTLTMDAIRNGYQLLDQYGRVLEDVEGVELNDAQAKAQRMKQARQAREDRDML
FT                   RLYAGPEDAERARDRRVEALELSISYEENNLAQLQAKLDDEIATAARNERAGREVPEVV
FT                   KEAIDRLQRQIITAEKKLSEFDQEIDQANQQYAPIIERLEVIEKGQN"
     MRIVVLLMAF ILVSPLLPSS VWARSGQRAN ERMPDGAYFR HETTDGVVHL NRTLTMDAIR        60
     NGYQLLDQYG RVLEDVEGVE LNDAQAKAQR MKQARQARED RDMLRLYAGP EDAERARDRR       120
     VEALELSISY EENNLAQLQA KLDDEIATAA RNERAGREVP EVVKEAIDRL QRQIITAEKK       180
     LSEFDQEIDQ ANQQYAPIIE RLEVIEKGQN                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page