(data stored in ACNUC7421 zone)

EMBL: AM286690.PE217

AM286690.PE217       Location/Qualifiers
FT   CDS             234902..235357
FT                   /transl_table=11
FT                   /locus_tag="ABO_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15665"
FT                   /db_xref="GOA:Q0VT55"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT55"
FT                   /protein_id="CAL15665.1"
FT                   /translation="MRRLIRRVKKIVKGVVALEFLLVSPLVIGLVYAAATYGVLFSWQM
FT                   RMQVSVDRAAAAATTLDRNTTSDPGVMAASLANGALANNVPTFMGSVPADACVTVGAEV
FT                   VCDLSIALTDGGCSEASGVATGPDQLGIFGGFPPLPDCLSVTSRVTI"
     MRRLIRRVKK IVKGVVALEF LLVSPLVIGL VYAAATYGVL FSWQMRMQVS VDRAAAAATT        60
     LDRNTTSDPG VMAASLANGA LANNVPTFMG SVPADACVTV GAEVVCDLSI ALTDGGCSEA       120
     SGVATGPDQL GIFGGFPPLP DCLSVTSRVT I                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page