(data stored in ACNUC7421 zone)

EMBL: AM286690.PE218

AM286690.PE218       Location/Qualifiers
FT   CDS             235444..236340
FT                   /transl_table=11
FT                   /locus_tag="ABO_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15666"
FT                   /db_xref="GOA:Q0VT54"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT54"
FT                   /protein_id="CAL15666.1"
FT                   /translation="MGARWLYMLPALILSVVAVILALVGLARDPSPAKPERAGADEALA
FT                   QQRAADKPKYTYWVATRELNIGSIVADDDFQKIDVSAPLSSALQADAQVVGQRLFQHVR
FT                   NGEILSQVHLEAGNRLAQSVPAQFRAFAIDIDNASAVGGLLEPGDLVDVLVHFRKGQDE
FT                   QPTSMILLKAIEVLAVKGQLQDADKTDEEKEKSRSRNATAVLAIPREALPKLLLADSNG
FT                   ELRLAMAGEDIGSEQNESAGGGAVGLSGKEQKELMLTTKLDSLFPEKKPVRRSVAPPRG
FT                   NKVEVYEGSTSRSTYVR"
     MGARWLYMLP ALILSVVAVI LALVGLARDP SPAKPERAGA DEALAQQRAA DKPKYTYWVA        60
     TRELNIGSIV ADDDFQKIDV SAPLSSALQA DAQVVGQRLF QHVRNGEILS QVHLEAGNRL       120
     AQSVPAQFRA FAIDIDNASA VGGLLEPGDL VDVLVHFRKG QDEQPTSMIL LKAIEVLAVK       180
     GQLQDADKTD EEKEKSRSRN ATAVLAIPRE ALPKLLLADS NGELRLAMAG EDIGSEQNES       240
     AGGGAVGLSG KEQKELMLTT KLDSLFPEKK PVRRSVAPPR GNKVEVYEGS TSRSTYVR         298
//

If you have problems or comments...

PBIL Back to PBIL home page