(data stored in ACNUC7421 zone)

EMBL: AM286690.PE230

AM286690.PE230       Location/Qualifiers
FT   CDS             247660..248313
FT                   /transl_table=11
FT                   /locus_tag="ABO_0230"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="glutathione S-transferase family protein identified
FT                   by sequencesimilarity; putative InterPro: Glutathione
FT                   S-transferase N terminus"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15678"
FT                   /db_xref="GOA:Q0VT42"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT42"
FT                   /protein_id="CAL15678.1"
FT                   /translation="MTSSFHCLYSFRRCPYAMRARLGLLFAEMRVELREVELKNKPAQM
FT                   LTISPKGTVPVLQLFDGTVIEESRDIMIWALEKNDPQGLLYTKGAGQIDALIEQNDSEF
FT                   KYWLDRYKYADRYPEKTQTEYRQCGEAFLQVLEGLLIKHPFLLGDNVTLADVGIMPFVR
FT                   QFAHVDRDAFYSLPYPNLQVWLKRWLQHPFFLQAMVKYKPWCEGDELVLFPSYG"
     MTSSFHCLYS FRRCPYAMRA RLGLLFAEMR VELREVELKN KPAQMLTISP KGTVPVLQLF        60
     DGTVIEESRD IMIWALEKND PQGLLYTKGA GQIDALIEQN DSEFKYWLDR YKYADRYPEK       120
     TQTEYRQCGE AFLQVLEGLL IKHPFLLGDN VTLADVGIMP FVRQFAHVDR DAFYSLPYPN       180
     LQVWLKRWLQ HPFFLQAMVK YKPWCEGDEL VLFPSYG                                217
//

If you have problems or comments...

PBIL Back to PBIL home page