(data stored in ACNUC7421 zone)

EMBL: AM286690.PE231

AM286690.PE231       Location/Qualifiers
FT   CDS             complement(248364..248753)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15679"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT41"
FT                   /protein_id="CAL15679.1"
FT                   /translation="MTLATMRQPLLILFTFFALISTAQAYEQDCKLDILHSAIGANHSF
FT                   NLKVTCSGYYNTLTYLLRAKQNKNGVSRLDSETGQLYIRGNDQTSGGITIEMQEGDKVS
FT                   IEAKILQACEVLGEATLEYTHKESR"
     MTLATMRQPL LILFTFFALI STAQAYEQDC KLDILHSAIG ANHSFNLKVT CSGYYNTLTY        60
     LLRAKQNKNG VSRLDSETGQ LYIRGNDQTS GGITIEMQEG DKVSIEAKIL QACEVLGEAT       120
     LEYTHKESR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page