(data stored in ACNUC7421 zone)

EMBL: AM286690.PE234

AM286690.PE234       Location/Qualifiers
FT   CDS             complement(251823..252464)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0234"
FT                   /product="Flagellar motor protein"
FT                   /note="OmpA family protein identified by match to PFAM
FT                   protein family HMMPF00691"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15682"
FT                   /db_xref="GOA:Q0VT38"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT38"
FT                   /inference="protein motif:HMMPFAM:HMMPF00691"
FT                   /protein_id="CAL15682.1"
FT                   /translation="MMDELHDSDAQASPVWAIFSDLMAALVGILVLLLVWVIGIQLELS
FT                   QSLEQEKAKRLAEEQRRMALEEALADPLASGRVTFNNGRIGISGSVLFQLNSDRLQPEG
FT                   KALLSDLVKPLQVFLSQHDDMLMVSGFTDALPINRGNGRYADNWGLSAQRALTVTRTLI
FT                   EQGMPADQVFAAAFGDNQPVAPNDDADSRARNRRVELTTVPRQSEKSDAP"
     MMDELHDSDA QASPVWAIFS DLMAALVGIL VLLLVWVIGI QLELSQSLEQ EKAKRLAEEQ        60
     RRMALEEALA DPLASGRVTF NNGRIGISGS VLFQLNSDRL QPEGKALLSD LVKPLQVFLS       120
     QHDDMLMVSG FTDALPINRG NGRYADNWGL SAQRALTVTR TLIEQGMPAD QVFAAAFGDN       180
     QPVAPNDDAD SRARNRRVEL TTVPRQSEKS DAP                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page