(data stored in ACNUC7421 zone)

EMBL: AM286690.PE237

AM286690.PE237       Location/Qualifiers
FT   CDS             255802..256083
FT                   /transl_table=11
FT                   /locus_tag="ABO_0237"
FT                   /product="conserved hypothetical protein"
FT                   /function="unknown"
FT                   /note="identified by sequencesimilarity"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15685"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT35"
FT                   /protein_id="CAL15685.1"
FT                   /translation="MIMEAGKQMIADIKSKLDELESELDQLEKQGEADRSTEAERHQLA
FT                   LEDVLTELQQRIDEYRELTGAGSVDGQANRQQLDNDLKELDDDFYGAN"
     MIMEAGKQMI ADIKSKLDEL ESELDQLEKQ GEADRSTEAE RHQLALEDVL TELQQRIDEY        60
     RELTGAGSVD GQANRQQLDN DLKELDDDFY GAN                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page