(data stored in ACNUC7421 zone)

EMBL: AM286690.PE239

AM286690.PE239       Location/Qualifiers
FT   CDS             257639..258928
FT                   /transl_table=11
FT                   /locus_tag="ABO_0239"
FT                   /product="Uncharacterized iron-regulated protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15687"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT33"
FT                   /protein_id="CAL15687.1"
FT                   /translation="MLTRLSTGGLLLATLFFSACSDEPQSSGAVVAQAYDQTQGKKVVS
FT                   HYADVALATYTDALAEARKLKTQIDALLAAPTEDSLTAARDAWRAARVPYMQSEVFRFG
FT                   NVVVDEWEGQVNAWPLDEGLIDYVDEDYHAVMGNPGARANIIASESLKIGEQALDLTDL
FT                   SAELLASLNELGGSEVNVATGYHAIEFLLWGQDLNGTDAGAGERPATDFATGPQATGGH
FT                   NARRREYLSVVTDLLINDLEVMVDEWRPGEENYRAELEADSVENGLRKMLFGMGSLSLG
FT                   ELAGERMKVALAAHSPEDEHDCFSDNTHASHFYNGKGIRNVYLGEYRRVNGETLTGPSL
FT                   SDLVAANKPAIDNQLKADLEASRAALQGLVDSANKGIHFDQLIAPGNSEGAATVNAAID
FT                   TLVAQTTSIEAAAAVLNIQALNPDTANHSF"
     MLTRLSTGGL LLATLFFSAC SDEPQSSGAV VAQAYDQTQG KKVVSHYADV ALATYTDALA        60
     EARKLKTQID ALLAAPTEDS LTAARDAWRA ARVPYMQSEV FRFGNVVVDE WEGQVNAWPL       120
     DEGLIDYVDE DYHAVMGNPG ARANIIASES LKIGEQALDL TDLSAELLAS LNELGGSEVN       180
     VATGYHAIEF LLWGQDLNGT DAGAGERPAT DFATGPQATG GHNARRREYL SVVTDLLIND       240
     LEVMVDEWRP GEENYRAELE ADSVENGLRK MLFGMGSLSL GELAGERMKV ALAAHSPEDE       300
     HDCFSDNTHA SHFYNGKGIR NVYLGEYRRV NGETLTGPSL SDLVAANKPA IDNQLKADLE       360
     ASRAALQGLV DSANKGIHFD QLIAPGNSEG AATVNAAIDT LVAQTTSIEA AAAVLNIQAL       420
     NPDTANHSF                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page