(data stored in ACNUC7421 zone)

EMBL: AM286690.PE240

AM286690.PE240       Location/Qualifiers
FT   CDS             259094..260488
FT                   /transl_table=11
FT                   /locus_tag="ABO_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15688"
FT                   /db_xref="GOA:Q0VT32"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT32"
FT                   /protein_id="CAL15688.1"
FT                   /translation="MRYFLLSLAALLAACDQGPTFTEAEPGEQLSAGKATVTKTDQNAF
FT                   SLPLANLPPSRRLDFSVGNSFFRNPWVIAPASTDARDGLGPLFNTNACQNCHIKDGRGH
FT                   PPGPDAKQAVSMLVRLSVPAKAEDDLTQGGLMPEPTYGGQFQDAAIPGVEPEGRVRVDY
FT                   RTRIVTFKDGYQVALRVPRLSFSNLAYGDMHPATLFSARIAPPVIGLGLLEAIPEADLL
FT                   AHADPEDADGDGISGRANRVWDRRNDTTAMGRFGWKAGQPSLRQQNAEAFANDMGLTSH
FT                   LVPTDSCSPAQHDCLAMPNGGDAEVSDSILDNVTFYTRNLAVPARRNVDDKQVLAGKSL
FT                   FFQANCQGCHVAVFTTGAEAAEPELANQTIRPYTDLLLHDMGPGLADGRPEFLANGQEW
FT                   RTPPLWGIGLTEAVNGHTQFLHDGRARNLMEAILWHEGEAAQSRDAVLAFDASQRAALL
FT                   AFLNSL"
     MRYFLLSLAA LLAACDQGPT FTEAEPGEQL SAGKATVTKT DQNAFSLPLA NLPPSRRLDF        60
     SVGNSFFRNP WVIAPASTDA RDGLGPLFNT NACQNCHIKD GRGHPPGPDA KQAVSMLVRL       120
     SVPAKAEDDL TQGGLMPEPT YGGQFQDAAI PGVEPEGRVR VDYRTRIVTF KDGYQVALRV       180
     PRLSFSNLAY GDMHPATLFS ARIAPPVIGL GLLEAIPEAD LLAHADPEDA DGDGISGRAN       240
     RVWDRRNDTT AMGRFGWKAG QPSLRQQNAE AFANDMGLTS HLVPTDSCSP AQHDCLAMPN       300
     GGDAEVSDSI LDNVTFYTRN LAVPARRNVD DKQVLAGKSL FFQANCQGCH VAVFTTGAEA       360
     AEPELANQTI RPYTDLLLHD MGPGLADGRP EFLANGQEWR TPPLWGIGLT EAVNGHTQFL       420
     HDGRARNLME AILWHEGEAA QSRDAVLAFD ASQRAALLAF LNSL                        464
//

If you have problems or comments...

PBIL Back to PBIL home page