(data stored in ACNUC7421 zone)

EMBL: AM286690.PE241

AM286690.PE241       Location/Qualifiers
FT   CDS             260514..261551
FT                   /transl_table=11
FT                   /locus_tag="ABO_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15689"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034984"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT31"
FT                   /protein_id="CAL15689.1"
FT                   /translation="MRALIMQGAVALSVLMLAACSNPRQEVTVQLATEVLLPAHQQWHD
FT                   SNAALMDSVEAYCADPQASVEKMKAAFFHAQSQWSYLQPLMIGPLSEGNRSWQVQFWPD
FT                   KRNLVVRQTEALLDEAGPLTGEQLEKASVVVQGLTAFEFVLFDESIALASSRDRYCPLL
FT                   KGIANHQWALSEEVLKLWRGPEGMLLQLSDFPNERYATADDGLAAILRVQITGVDVLKK
FT                   KLGVPMGRLNKGVAQPYQAEAWRSQQSIENLQASLKGAWAVWQRVRSLVSDEGLVSDID
FT                   QAYADVNSRMEALPGPLVELVQAPSHRDTLAALYTALDQLENRQQIELARALNIQIGFN
FT                   ANDGD"
     MRALIMQGAV ALSVLMLAAC SNPRQEVTVQ LATEVLLPAH QQWHDSNAAL MDSVEAYCAD        60
     PQASVEKMKA AFFHAQSQWS YLQPLMIGPL SEGNRSWQVQ FWPDKRNLVV RQTEALLDEA       120
     GPLTGEQLEK ASVVVQGLTA FEFVLFDESI ALASSRDRYC PLLKGIANHQ WALSEEVLKL       180
     WRGPEGMLLQ LSDFPNERYA TADDGLAAIL RVQITGVDVL KKKLGVPMGR LNKGVAQPYQ       240
     AEAWRSQQSI ENLQASLKGA WAVWQRVRSL VSDEGLVSDI DQAYADVNSR MEALPGPLVE       300
     LVQAPSHRDT LAALYTALDQ LENRQQIELA RALNIQIGFN ANDGD                       345
//

If you have problems or comments...

PBIL Back to PBIL home page