(data stored in ACNUC7421 zone)

EMBL: AM286690.PE243

AM286690.PE243       Location/Qualifiers
FT   CDS             complement(262771..263163)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15691"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT07"
FT                   /protein_id="CAL15691.1"
FT                   /translation="MKWTIGIAILLASQFAAADYYSSLDDDTCWDARNSGGAPCMVVHN
FT                   TKWSQYSKGNFIVTYRNSCNNRIYARFCNERKDGSEDCGASGIGAGKTKSWSTSNANGR
FT                   YSYRSIGVERGSKDWVCSGKVSGWHD"
     MKWTIGIAIL LASQFAAADY YSSLDDDTCW DARNSGGAPC MVVHNTKWSQ YSKGNFIVTY        60
     RNSCNNRIYA RFCNERKDGS EDCGASGIGA GKTKSWSTSN ANGRYSYRSI GVERGSKDWV       120
     CSGKVSGWHD                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page