(data stored in ACNUC7421 zone)

EMBL: AM286690.PE244

AM286690.PE244       Location/Qualifiers
FT   CDS             complement(263356..263772)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0244"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="transcriptional regulator MerR family identified by
FT                   match to PFAM protein family HMMPF00376 InterPro: Bacterial
FT                   regulatory proteins MerR family"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15692"
FT                   /db_xref="GOA:Q0VT06"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT06"
FT                   /inference="protein motif:HMMPFAM:HMMPF00376"
FT                   /protein_id="CAL15692.1"
FT                   /translation="MPTLFSIGALSNAAGCKVETIRYYEKIGLMPEPARSEGGQRRYHQ
FT                   RHRERLAFIRHSRELGFTLEDIRELLTMSEQHGCADDIARRHLETVEQRIRSLSALRDE
FT                   LGRMINECEQGRPGECRVIEVLSDHRKCTTEHGH"
     MPTLFSIGAL SNAAGCKVET IRYYEKIGLM PEPARSEGGQ RRYHQRHRER LAFIRHSREL        60
     GFTLEDIREL LTMSEQHGCA DDIARRHLET VEQRIRSLSA LRDELGRMIN ECEQGRPGEC       120
     RVIEVLSDHR KCTTEHGH                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page