(data stored in ACNUC7421 zone)

EMBL: AM286690.PE246

AM286690.PE246       Location/Qualifiers
FT   CDS             264653..264877
FT                   /transl_table=11
FT                   /locus_tag="ABO_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15694"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT04"
FT                   /protein_id="CAL15694.1"
FT                   /translation="MSSMEFKQEDLTALIERTMPFGKYAGRVLIDLPEPYLLWFTKKGF
FT                   PKGELGRLMALALMLKMDGTEGLLEPLRK"
     MSSMEFKQED LTALIERTMP FGKYAGRVLI DLPEPYLLWF TKKGFPKGEL GRLMALALML        60
     KMDGTEGLLE PLRK                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page