(data stored in ACNUC7421 zone)

EMBL: AM286690.PE247

AM286690.PE247       Location/Qualifiers
FT   CDS             264936..265616
FT                   /transl_table=11
FT                   /locus_tag="ABO_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15695"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT03"
FT                   /protein_id="CAL15695.1"
FT                   /translation="MPLLEVVANNVWAYAIPHHFMGLHVGARMTVVKLSSGGLLLHSPV
FT                   PVDDALAGELAALGEVAHIVCPNLFHHVFADEVKQRYPQAVLHGPAKLASKRKDLALDA
FT                   VLSQTPHPDWGDDFELVFIEGSMLHETVFYHCSSKTLIAADLIENFHQCDHGFTRWYLK
FT                   LGGLWKSPGWHPVLRLVYLNRRKARASVTRILEWPFEKLSLAHGEVITENARNQVRHGM
FT                   EWLL"
     MPLLEVVANN VWAYAIPHHF MGLHVGARMT VVKLSSGGLL LHSPVPVDDA LAGELAALGE        60
     VAHIVCPNLF HHVFADEVKQ RYPQAVLHGP AKLASKRKDL ALDAVLSQTP HPDWGDDFEL       120
     VFIEGSMLHE TVFYHCSSKT LIAADLIENF HQCDHGFTRW YLKLGGLWKS PGWHPVLRLV       180
     YLNRRKARAS VTRILEWPFE KLSLAHGEVI TENARNQVRH GMEWLL                      226
//

If you have problems or comments...

PBIL Back to PBIL home page