(data stored in ACNUC7421 zone)

EMBL: AM286690.PE248

AM286690.PE248       Location/Qualifiers
FT   CDS             265732..267018
FT                   /transl_table=11
FT                   /locus_tag="ABO_0248"
FT                   /product="ABC export system, membrane fusion protein"
FT                   /note="ABC export system membrane fusion protein identified
FT                   by sequencesimilarity; putative InterPro: HlyD family
FT                   secretion protein"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15696"
FT                   /db_xref="GOA:Q0VT02"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VT02"
FT                   /protein_id="CAL15696.1"
FT                   /translation="MAAWHSAVRAFNFELAISSLHISCNISRYIPHHHYWSVELPMPRW
FT                   IRRFPKTVLFVVVLIVCLLFAGWRWGFSSAPATQWETATVERGDVEELVTALGTLEPGD
FT                   YVDVGAQVSGQLTHLYVDVGDSVEEGQLLAEIDASVQQTQVDAGLAELEALRAQLEQRQ
FT                   AELNLAELQYQRQQRLRDANATSEDAFQSAESNLAITGAQIKVLQAQIRQKQASVEGDQ
FT                   ATLGYAKIYAPRSGTVVSLDAREGQTLNANQTTPTLMRIADLSVMTISTEVSEADVHRL
FT                   SAGMPVYFNTLGNETVRYDSELRQVLPTPEVVNNVVLYTAEFDVANDNGQLMSGMTAQV
FT                   FFVVNSARDVLSLPMAAVKRAGRGAWKVQVLDSKGEPQDQPVKIGIDNRVRIVIDEGLE
FT                   EGDVVTLSQASSNVALKKNKDSLPRQGRF"
     MAAWHSAVRA FNFELAISSL HISCNISRYI PHHHYWSVEL PMPRWIRRFP KTVLFVVVLI        60
     VCLLFAGWRW GFSSAPATQW ETATVERGDV EELVTALGTL EPGDYVDVGA QVSGQLTHLY       120
     VDVGDSVEEG QLLAEIDASV QQTQVDAGLA ELEALRAQLE QRQAELNLAE LQYQRQQRLR       180
     DANATSEDAF QSAESNLAIT GAQIKVLQAQ IRQKQASVEG DQATLGYAKI YAPRSGTVVS       240
     LDAREGQTLN ANQTTPTLMR IADLSVMTIS TEVSEADVHR LSAGMPVYFN TLGNETVRYD       300
     SELRQVLPTP EVVNNVVLYT AEFDVANDNG QLMSGMTAQV FFVVNSARDV LSLPMAAVKR       360
     AGRGAWKVQV LDSKGEPQDQ PVKIGIDNRV RIVIDEGLEE GDVVTLSQAS SNVALKKNKD       420
     SLPRQGRF                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page