(data stored in ACNUC7421 zone)

EMBL: AM286690.PE249

AM286690.PE249       Location/Qualifiers
FT   CDS             267018..268952
FT                   /transl_table=11
FT                   /locus_tag="ABO_0249"
FT                   /product="ABC transporter, ATP-binding protein/permease,
FT                   putative"
FT                   /function="responsible for the controlled efflux and influx
FT                   of substances (allocrites) across cellular membranes."
FT                   /note="(ABC transporter, ATP-binding protein/permease,
FT                   putative) identified by match to TIGR protein family
FT                   HMMTIGR01740"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15697"
FT                   /db_xref="GOA:Q0VT01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0VT01"
FT                   /inference="protein motif:HMMTIGR:HMMTIGR01740"
FT                   /protein_id="CAL15697.1"
FT                   /translation="MPLIELCNIRKRYPAGDQDVEVLHGIDLSIEAGEFLAIMGSSGSG
FT                   KSTLMHILGCLDQPSDGEYRFSGQPVTAMDHDQLAWLRREMFGFVFQSYHLIGTASAWE
FT                   NVALPAIYAGVPREERKQRAQQLLTDLGLEDRLENRPSQLSGGQQQRVSIARALMNGGK
FT                   VILADEPTGALDSASGEAVMDQLRSLAEQGHTVIVITHDAKVAAHADRVVEIHDGNLIS
FT                   DTRHHDHLHERAKPVSAPPKESVMPDPGEVMEAVVMALRSLRANWMRTLLTLLGIVIGV
FT                   GAVVVMLAIGEGAKQDVVAQINERGTNLLVVRPDRGMQRVADGVIATLVPADAQALESL
FT                   PNISIAVPEISGNVTARANGMDISTSVQAVSEDFPSLRDWQPVQGIFFGEEDLKSYSPV
FT                   AVIGQTVKENLFPEGDPLGQFLLLDSIPFQVIGVMSAQGASDRGEDQDDVVIVPLSTGT
FT                   LRLFGQNYLNSITVAVDDVTQIDATEAAAVALLTQRHGKQDVRVFNMASLLEMVSETQN
FT                   TLTALLGSIAAISLLVGGIGVMNIMLVSVTERIHEIGIRMATGARQRNILQQFLTESVV
FT                   VSALGGIVGVVIGVLVGWLLMLFGMAIVFSVPVMVVSFVCAAGIGLLFGFAPALKAARL
FT                   NPVEALSND"
     MPLIELCNIR KRYPAGDQDV EVLHGIDLSI EAGEFLAIMG SSGSGKSTLM HILGCLDQPS        60
     DGEYRFSGQP VTAMDHDQLA WLRREMFGFV FQSYHLIGTA SAWENVALPA IYAGVPREER       120
     KQRAQQLLTD LGLEDRLENR PSQLSGGQQQ RVSIARALMN GGKVILADEP TGALDSASGE       180
     AVMDQLRSLA EQGHTVIVIT HDAKVAAHAD RVVEIHDGNL ISDTRHHDHL HERAKPVSAP       240
     PKESVMPDPG EVMEAVVMAL RSLRANWMRT LLTLLGIVIG VGAVVVMLAI GEGAKQDVVA       300
     QINERGTNLL VVRPDRGMQR VADGVIATLV PADAQALESL PNISIAVPEI SGNVTARANG       360
     MDISTSVQAV SEDFPSLRDW QPVQGIFFGE EDLKSYSPVA VIGQTVKENL FPEGDPLGQF       420
     LLLDSIPFQV IGVMSAQGAS DRGEDQDDVV IVPLSTGTLR LFGQNYLNSI TVAVDDVTQI       480
     DATEAAAVAL LTQRHGKQDV RVFNMASLLE MVSETQNTLT ALLGSIAAIS LLVGGIGVMN       540
     IMLVSVTERI HEIGIRMATG ARQRNILQQF LTESVVVSAL GGIVGVVIGV LVGWLLMLFG       600
     MAIVFSVPVM VVSFVCAAGI GLLFGFAPAL KAARLNPVEA LSND                        644
//

If you have problems or comments...

PBIL Back to PBIL home page