(data stored in ACNUC7421 zone)

EMBL: AM286690.PE25

AM286690.PE25        Location/Qualifiers
FT   CDS             complement(27828..28688)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0025"
FT                   /product="pirin family protein"
FT                   /function="unknown"
FT                   /note="conserved hypothetical protein identified by
FT                   sequence similarity; putative InterPro: DUF209"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15473"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VTN5"
FT                   /protein_id="CAL15473.1"
FT                   /translation="MERSILNTFRAMDTSDGAGVKLKRALGYTPLMRLDPFLMLDAFSS
FT                   DNPDDYIAGFPPHPHRGFETVTYLVEGHMRHRDHLGNEGDLKQGGVQWMTAGSGIIHEE
FT                   MPQQENGLLRGFQLWINLPAAEKMKPATYRDIADTEMPRLDLASGGQIKAIAGEVTIAE
FT                   QTLSAPMKGGQTNPLYLDVVLRPRENLTVPLARGHNAFVYLFEGRIEVSGETVETHHLA
FT                   TLTDGDNVKLVARKRGARLLLLSGKPLGEPIVQYGPFVMNTQSEINQTLRDYRDGTLTA
FT                   QSSLL"
     MERSILNTFR AMDTSDGAGV KLKRALGYTP LMRLDPFLML DAFSSDNPDD YIAGFPPHPH        60
     RGFETVTYLV EGHMRHRDHL GNEGDLKQGG VQWMTAGSGI IHEEMPQQEN GLLRGFQLWI       120
     NLPAAEKMKP ATYRDIADTE MPRLDLASGG QIKAIAGEVT IAEQTLSAPM KGGQTNPLYL       180
     DVVLRPRENL TVPLARGHNA FVYLFEGRIE VSGETVETHH LATLTDGDNV KLVARKRGAR       240
     LLLLSGKPLG EPIVQYGPFV MNTQSEINQT LRDYRDGTLT AQSSLL                      286
//

If you have problems or comments...

PBIL Back to PBIL home page