(data stored in ACNUC7421 zone)

EMBL: AM286690.PE264

AM286690.PE264       Location/Qualifiers
FT   CDS             complement(283751..286123)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0264"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="S1 RNA binding domain protein identified by match to
FT                   PFAM protein family HMMPF00575"
FT                   /note="Function unclear"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15712"
FT                   /db_xref="GOA:Q0VSY6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSY6"
FT                   /inference="protein motif:HMMPFAM:HMMPF00575"
FT                   /protein_id="CAL15712.1"
FT                   /translation="MRSIEQIIAEEIGCQERQVNAAVALLDEGSTVPFIARYRKEVTGG
FT                   LDDTQLRNLEERLRYLREMEERRETILKSITEQEKLTPELEKAIKAADTKTRLEDLYLP
FT                   YKPKRRTRAQIAREAGLEPLANSLIDDPTQDPEALAAGYLNEEHKIATAKDALDGAKQI
FT                   LMERFAEDAELLTRLRTFLWDKGQIQAKVVEGKEKDGAKFSDYFDHSETLKGIPSHRAL
FT                   ALFRGRNEGILHVSMVLPEELENAQPHPCEAMVTAVADWQHAGRAADDWLKEVMRWTWK
FT                   IKLNTHLETELLGRVREMGEEEAIQVFARNLKSLLMASPAGPKCTMGLDPGLRTGVKVV
FT                   VVDATGKLLEHTTIFPHQPKKQWDQSLSKLTALSKQHGVELIAIGNGTASRETDKLAGE
FT                   VVKLLKDQPIQKIIVSEAGASVYSASEMAALEFPELDVSFRGAVSIARRLQDPLAELVK
FT                   IDPKAIGVGQYQHDVSQVKLSRSLDTVVEDCVNSVGVDVNTASAPLLARIAGLNSTIAG
FT                   NIVSFREKNGAFASRANLKLVPRLGDKTFEQAAGFLRIMNGENPLDRSSVHPEAYPVVE
FT                   RIAEQHGRPLKDLVGDVPFLKKVNAADFTDDNFGLPTVTDILSELEKPGRDPRPEFKAA
FT                   VLKEGVETLKDLKQNMILEGTVTNVTNFGAFVDVGVHQDGLVHVSALADKFVEDPHQVV
FT                   APGDIVKVKVLDVDLDRKRISLTMRMGDQPTEKPSGQRPTSNRANQANKGNNPRRGGGN
FT                   GGAQRAGGQPQGGGGTFADLFAKAKEEKQKKDSKKRS"
     MRSIEQIIAE EIGCQERQVN AAVALLDEGS TVPFIARYRK EVTGGLDDTQ LRNLEERLRY        60
     LREMEERRET ILKSITEQEK LTPELEKAIK AADTKTRLED LYLPYKPKRR TRAQIAREAG       120
     LEPLANSLID DPTQDPEALA AGYLNEEHKI ATAKDALDGA KQILMERFAE DAELLTRLRT       180
     FLWDKGQIQA KVVEGKEKDG AKFSDYFDHS ETLKGIPSHR ALALFRGRNE GILHVSMVLP       240
     EELENAQPHP CEAMVTAVAD WQHAGRAADD WLKEVMRWTW KIKLNTHLET ELLGRVREMG       300
     EEEAIQVFAR NLKSLLMASP AGPKCTMGLD PGLRTGVKVV VVDATGKLLE HTTIFPHQPK       360
     KQWDQSLSKL TALSKQHGVE LIAIGNGTAS RETDKLAGEV VKLLKDQPIQ KIIVSEAGAS       420
     VYSASEMAAL EFPELDVSFR GAVSIARRLQ DPLAELVKID PKAIGVGQYQ HDVSQVKLSR       480
     SLDTVVEDCV NSVGVDVNTA SAPLLARIAG LNSTIAGNIV SFREKNGAFA SRANLKLVPR       540
     LGDKTFEQAA GFLRIMNGEN PLDRSSVHPE AYPVVERIAE QHGRPLKDLV GDVPFLKKVN       600
     AADFTDDNFG LPTVTDILSE LEKPGRDPRP EFKAAVLKEG VETLKDLKQN MILEGTVTNV       660
     TNFGAFVDVG VHQDGLVHVS ALADKFVEDP HQVVAPGDIV KVKVLDVDLD RKRISLTMRM       720
     GDQPTEKPSG QRPTSNRANQ ANKGNNPRRG GGNGGAQRAG GQPQGGGGTF ADLFAKAKEE       780
     KQKKDSKKRS                                                              790
//

If you have problems or comments...

PBIL Back to PBIL home page