(data stored in ACNUC7421 zone)

EMBL: AM286690.PE265

AM286690.PE265       Location/Qualifiers
FT   CDS             complement(286306..286668)
FT                   /transl_table=11
FT                   /gene="pilH"
FT                   /locus_tag="ABO_0265"
FT                   /product="regulatory protein pilH family"
FT                   /function="FOG"
FT                   /note="(PilH; regulatory protein pilH family) identified by
FT                   sequence similarity; putative InterPro: Response regulator
FT                   receiver domain"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15713"
FT                   /db_xref="GOA:Q0VSY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSY5"
FT                   /protein_id="CAL15713.1"
FT                   /translation="MAKILVVDDSPTQRSNLVKIVQGQGHDVVTASNGMEGIEKAKQEH
FT                   PDLILMDVVMPELNGFQATRKITRDPVTESIPIILVTTKDQETDKVWGERQGAFGYVVK
FT                   PPQEAELVAKINEALA"
     MAKILVVDDS PTQRSNLVKI VQGQGHDVVT ASNGMEGIEK AKQEHPDLIL MDVVMPELNG        60
     FQATRKITRD PVTESIPIIL VTTKDQETDK VWGERQGAFG YVVKPPQEAE LVAKINEALA       120
//

If you have problems or comments...

PBIL Back to PBIL home page