(data stored in ACNUC7421 zone)

EMBL: AM286690.PE271

AM286690.PE271       Location/Qualifiers
FT   CDS             295758..296408
FT                   /transl_table=11
FT                   /locus_tag="ABO_0271"
FT                   /product="potassium uptake protein TrkA"
FT                   /note="(trkA) identified by match to PFAM protein family
FT                   HMMPF02080 InterPro: KTN NAD-binding domain"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15719"
FT                   /db_xref="GOA:Q0VSX9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSX9"
FT                   /inference="protein motif:HMMPFAM:HMMPF02080"
FT                   /protein_id="CAL15719.1"
FT                   /translation="MKHQYAVIGLGSFGSTIAQELTRLGHDVMGVDIDGERVECYADKL
FT                   SQTLIADGTNDKVIAELEMTAFDAVVVAIGENLEASILTTLALKSAEVEQVWVKAISEP
FT                   HHRILSRLGANRIIHPEHEMGIRVAQTIVHPEMLDYISLGNDWLVVEVKVDKRFAGKAA
FT                   SELPLGDDELRLALVKRGTQVWQSPFEDLLLQERDQLVLMGTLNDLLRFSKAQ"
     MKHQYAVIGL GSFGSTIAQE LTRLGHDVMG VDIDGERVEC YADKLSQTLI ADGTNDKVIA        60
     ELEMTAFDAV VVAIGENLEA SILTTLALKS AEVEQVWVKA ISEPHHRILS RLGANRIIHP       120
     EHEMGIRVAQ TIVHPEMLDY ISLGNDWLVV EVKVDKRFAG KAASELPLGD DELRLALVKR       180
     GTQVWQSPFE DLLLQERDQL VLMGTLNDLL RFSKAQ                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page