(data stored in ACNUC7421 zone)

EMBL: AM286690.PE278

AM286690.PE278       Location/Qualifiers
FT   CDS             complement(303717..304370)
FT                   /transl_table=11
FT                   /locus_tag="ABO_0278"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /function="Predicted hydrolase"
FT                   /note="identified by match to PFAM protein family
FT                   HMMPF00702 InterPro: Haloacid dehalogenase/epoxide
FT                   hydrolase family"
FT                   /note="Family membership"
FT                   /db_xref="EnsemblGenomes-Gn:ABO_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAL15726"
FT                   /db_xref="GOA:Q0VSX2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VSX2"
FT                   /inference="protein motif:HMMPFAM:HMMPF00702"
FT                   /protein_id="CAL15726.1"
FT                   /translation="MIDWQSVDTVLLDMDGTLLDLQFDNWFWQQHVPNCYAQQRGLEQV
FT                   EANRIIHDWITSHQGTLNWYCLDFWTAELGLEIAHLKRAAGDRISVRPGAETFLQKLKA
FT                   SDKQVIMVTNAHRDALHLKIARTGIDQYFDELVSSHDYGHPKEAQSFWQHLQRHLPFER
FT                   DRALLVDDSLPVLHSARKYGIGQPVSILHPDSSLPKRSDTAPFPAIDDFLTVLP"
     MIDWQSVDTV LLDMDGTLLD LQFDNWFWQQ HVPNCYAQQR GLEQVEANRI IHDWITSHQG        60
     TLNWYCLDFW TAELGLEIAH LKRAAGDRIS VRPGAETFLQ KLKASDKQVI MVTNAHRDAL       120
     HLKIARTGID QYFDELVSSH DYGHPKEAQS FWQHLQRHLP FERDRALLVD DSLPVLHSAR       180
     KYGIGQPVSI LHPDSSLPKR SDTAPFPAID DFLTVLP                                217
//

If you have problems or comments...

PBIL Back to PBIL home page